missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human CXCL3 Full-length ORF (NP_002081.2, 1 a.a. - 107 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00002921-P01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16198497

  • 458.00€ / 25 microgramos


Fecha estimada de envío
21-10-2020
Añadir a la cesta

Descripción

Descripción

Sequence: MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
Especificaciones

Especificaciones

NP_002081.2
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.7kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CINC-2b|GRO3|GROg|MIP-2b|MIP2B|SCYB3
CXCL3
Yes
wheat germ expression system
Liquid
2921
CXCL3 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MAHATLSAAPSNPRLLRVALLLLLLVAASRRAAGASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
RUO
CXCL3
Wheat Germ (in vitro)
GST
Videos
Documentos