missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human COX8C Full-length ORF (NP_892016.1, 1 a.a. - 72 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00341947-P01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16170214

  • 508.00€ / 25 microgramos
Fecha estimada de envío: 28-08-2024
para ver el stock

Descripción

Descripción

Sequence: MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAEMAVGLVVFFTTFLTPAAYVLGNLKQFRRN
Especificaciones

Especificaciones

NP_892016.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
34.5kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
COX8-3/MGC119774/MGC119775
COX8C
Recombinant
wheat germ expression system
Antibody Production, Protein Array, ELISA, Western Blot
341947
COX8C (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAEMAVGLVVFFTTFLTPAAYVLGNLKQFRRN
RUO
COX8C
Wheat Germ (in vitro)
GST
Liquid
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales