missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CLDN5 Partial ORF (NP_003268, 29 a.a. - 81 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00007122-Q01.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]
Sequence: MWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAAREspecificaciones
| NP_003268 | |
| Liquid | |
| 7122 | |
| CLDN5 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| AWAL/BEC1/CPETRL1/TMVCF | |
| CLDN5 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 31.57kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAAR | |
| RUO | |
| CLDN5 | |
| Wheat Germ (in vitro) | |
| GST |