missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CITED4 Partial ORF (NP_597724.1, 131 a.a. - 184 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00163732-Q01.10ug
Detalles adicionales : Peso : 0.02000kg
Descripción
CITED4 belongs to a family of transcriptional coactivators that bind several proteins, including CREB-binding protein (MIM 600140) and p300 (MIM 602700).[supplied by OMIM]
Sequence: GMDAELIDEEALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSAPPAGSVSCEspecificaciones
| NP_597724.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 31.68kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| GMDAELIDEEALTSLELELGLHRVRELPELFLGQSEFDCFSDLGSAPPAGSVSC | |
| RUO | |
| CITED4 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 163732 | |
| CITED4 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CITED4 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |