missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human CETN1 Partial ORF (AAH29515.1, 16 a.a. - 94 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00001068-Q02.25ug
Detalles adicionales : Peso : 0.02000kg
Descripción
The protein encoded by this gene plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. This encoded protein is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle. [provided by RefSeq]
Sequence: KRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTEspecificaciones
| AAH29515.1 | |
| Liquid | |
| 1068 | |
| CETN1 (Human) Recombinant Protein (Q02) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CEN1/CETN | |
| CETN1 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 34.32kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| KRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMT | |
| RUO | |
| CETN1 | |
| Wheat Germ (in vitro) | |
| GST |