Learn More
Abnova™ Human CDSN Partial ORF (NP_001255, 306 a.a. - 355 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00001041-Q01.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
This gene encodes a protein found in corneodesmosomes, which localize to human epidermis and other cornified squamous epithelia. During maturation of the cornified layers, the protein undergoes a series of cleavages, which are thought to be required for desquamation. The gene is located in the major histocompatibility complex (MHC) class I region on chromosome 6. [provided by RefSeq]
Sequence: YLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNPEspecificaciones
NP_001255 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
31.24kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
YLVPGMTYSKGKIYPVGYFTKENPVKGSPGVPSFAAGPPISEGKYFSSNP | |
RUO | |
CDSN | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
1041 | |
CDSN (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
D6S586E/HTSS/S | |
CDSN | |
Recombinant | |
wheat germ expression system |