Learn More
Abnova™ Human CALN1 Partial ORF (NP_113656.1, 36 a.a. - 106 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00083698-Q03.25ug
Detalles adicionales : Peso : 0.02000kg
Descripción
This gene encodes a protein with high similarity to the calcium-binding proteins of the calmodulin family. The encoded protein contains two EF-hand domains and potential calcium-binding sites. Alternative splicing results in multiple transcript variants. [provided by RefSeq]
Sequence: EELDEIREAFRVLDRDGNGFISKQELGMAMRSLGYMPSEVELAIIMQRLDMDGDGQVDFDEFMTILGPKLVEspecificaciones
AAH20200 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
33.55kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
EELDEIREAFRVLDRDGNGFISKQELGMAMRSLGYMPSEVELAIIMQRLDMDGDGQVDFDEFMTILGPKLV | |
RUO | |
CALN1 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
83698 | |
CALN1 (Human) Recombinant Protein (Q03) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
CALN1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |