missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human Ca1 Partial Orf (Aah27890.1, 12 A.A.-150 A.A.) Recombinant Protein With Gst Tag At N-Terminal.

Recombinant proteins expressed from in vitro wheat germ system. Such proteins mirror the conformation and folding of the native proteins in the eukaryotic biological system.

Marca:  Abnova™ H00000759-Q01.25ug

Detalles adicionales : Peso : 0.02000kg

 Ver más versiones de este producto

Código de producto. 16023705

  • 545.00€ / 25 microgramos
Fecha estimada de envío: 09-08-2022
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

  • Good Folding
  • Excellent amino acids labeling

Immunogen Sequence: NGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMK

Especificaciones

Especificaciones

AAH27890.1
Liquid
759
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Car1
CA1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
CA1 (Human) Recombinant Protein (Q01)
12.5% SDS-PAGE Stained with Coomassie Blue
NGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMK
RUO
CA1
GST
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales

For Research Use Only