missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human Ca1 Partial Orf (Aah27890.1, 12 A.A.-150 A.A.) Recombinant Protein With Gst Tag At N-Terminal.
Recombinant proteins expressed from in vitro wheat germ system. Such proteins mirror the conformation and folding of the native proteins in the eukaryotic biological system.
Marca: Abnova™ H00000759-Q01.25ug
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
- Good Folding
- Excellent amino acids labeling
Immunogen Sequence: NGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMK
Especificaciones
| AAH27890.1 | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| CA1 (Human) Recombinant Protein (Q01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue | |
| NGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMK | |
| RUO | |
| CA1 | |
| GST |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 759 | |
| Glutathione Sepharose 4 Fast Flow | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| Car1 | |
| CA1 | |
| Liquid |
For Research Use Only