missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human Ca1 Partial Orf (Aah27890.1, 12 A.A.-150 A.A.) Recombinant Protein With Gst Tag At N-Terminal.

Recombinant proteins expressed from in vitro wheat germ system. Such proteins mirror the conformation and folding of the native proteins in the eukaryotic biological system.

359.00€ - 545.00€

Especificaciones

Formato Liquid
Estado normativo RUO
Formulación 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Número de acceso AAH27890.1
Método de purificación Glutathione Sepharose 4 Fast Flow
Ver más especificaciones

Productos 2
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
16013705
Ver documentos Detalles de la promoción
Abnova™
H00000759-Q01.10UG
10 ug
359.00€
10 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 02-08-2022
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
16023705
Ver documentos Detalles de la promoción
Abnova™
H00000759-Q01.25UG
25 ug
545.00€
25 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 02-08-2022
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

  • Good Folding
  • Excellent amino acids labeling

Immunogen Sequence: NGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMK

Especificaciones

Especificaciones

Liquid
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Glutathione Sepharose 4 Fast Flow
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
RUO
AAH27890.1
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
SDS
Product Certifications

For Research Use Only