Abnova™ Human C9orf152 Full-length ORF (NP_001013011.1, 1 a.a. - 218 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca: Abnova™ H00401546-P01.25ug

Ver más versiones de este producto

Código de producto. 16120654

508.00€ / 25 microgramos

Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Sequence: MAEGSRTQAPGKGPPLSIQFLRAQYEGLKRQQRTQAHLLVLPKGGNTPAPAESMVNAVWINKERRSSLSLEEADSEVEGRLEEAAQGCLQAPKSPWHTHLEMHCLVQTSPQDTSHQVHHRGKLVGSDQRLPPEGDTHLFETNQMTQQGTGIPEAAQLPCQVGNTQTKAVESGLKFSTQCPLSIKNPHRSGKPAYYPFPQRKTPRISQAARNLGLYGSA

Especificaciones

Número de acceso	NP_001013011.1
Formulación	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Peso molecular	50.3kDa
Método de purificación	Glutathione Sepharose 4 Fast Flow
Cantidad	25 ug
Requisitos de almacenamiento	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias de gen	MGC131682/bA470J20.2
Símbolo de gen	C9orf152
Recombinante	Recombinant
Sistema de expresión	wheat germ expression system

Para utilizar con (aplicación)	Antibody Production, Protein Array, ELISA, Western Blot
ID de gen (Entrez)	401546
Nombre	C9orf152 (Human) Recombinant Protein (P01)
Pruebas de control de calidad	12.5% SDS-PAGE Stained with Coomassie Blue.
Inmunógeno	MAEGSRTQAPGKGPPLSIQFLRAQYEGLKRQQRTQAHLLVLPKGGNTPAPAESMVNAVWINKERRSSLSLEEADSEVEGRLEEAAQGCLQAPKSPWHTHLEMHCLVQTSPQDTSHQVHHRGKLVGSDQRLPPEGDTHLFETNQMTQQGTGIPEAAQLPCQVGNTQTKAVESGLKFSTQCPLSIKNPHRSGKPAYYPFPQRKTPRISQAARNLGLYGSA
Estado normativo	RUO
Nombre común	C9orf152
Especie	Wheat Germ (in vitro)
Etiqueta de proteína	GST
Formulario	Liquid

Sugerencias de productos

Abnova™ Human C9orf152 Full-length ORF (NP_001013011.1, 1 a.a. - 218 a.a.) Recombinant Protein with GST-tag at N-terminal

Descripción

Especificaciones

Sugerencias de productos

Documentos

Ofertas especiales