missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human C17orf35 Partial ORF (NP_003867, 128 a.a. - 192 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00008834-Q01.10ug
Detalles adicionales : Peso : 0.00010kg
Descripción
The function of putative receptor protein is unknown.
Sequence: FDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIALAALVYCVKKIYELYAVEspecificaciones
| NP_003867 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 32.89kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| FDPCCKYQVEYDAYKLSRLPLHTLTSSTPVVLVRKDDLHRKRLHNTIALAALVYCVKKIYELYAV | |
| RUO | |
| TMEM11 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 8834 | |
| C17orf35 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| C17orf35/PM1/PMI | |
| TMEM11 | |
| Recombinant | |
| wheat germ expression system |