missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human BRAF Partial ORF (NP_004324, 346 a.a. - 445 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00000673-Q01.10ug
Detalles adicionales : Peso : 0.02000kg
Descripción
This gene encodes a protein belonging to the raf/mil family of serine/threonine protein kinases. This protein plays a role in regulating the MAP kinase/ERKs signaling pathway, which affects cell division, differentiation, and secretion. Mutations in this gene are associated with cardiofaciocutaneous syndrome, a disease characterized by heart defects, mental retardation and a distinctive facial appearance. Mutations in this gene have also been associated with various cancers, including non-Hodgkin lymphoma, colorectal cancer, malignant melanoma, thyroid carcinoma, non-small cell lung carcinoma, and adenocarcinoma of lung. A pseudogene, which is located on chromosome X, has been identified for this gene. [provided by RefSeq]
Sequence: FRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRDEspecificaciones
| NP_004324 | |
| Liquid | |
| 673 | |
| BRAF (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| B-RAF1/BRAF1/FLJ95109/MGC126806/MGC138284/RAFB1 | |
| BRAF | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.74kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| FRPADEDHRNQFGQRDRSSSAPNVHINTIEPVNIDDLIRDQGFRGDGGSTTGLSATPPASLPGSLTNVKALQKSPGPQRERKSSSSSEDRNRMKTLGRRD | |
| RUO | |
| BRAF | |
| Wheat Germ (in vitro) | |
| GST |