Learn More
Abnova™ Human BMP2 Partial ORF (NP_001191, 231 a.a. - 330 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00000650-Q03.25ug
Detalles adicionales : Peso : 0.02000kg
Descripción
The protein encoded by this gene belongs to the transforming growth factor-beta (TGFB) superfamily. The encoded protein acts as a disulfide-linked homodimer and induces bone and cartilage formation. [provided by RefSeq]
Sequence: AHLEEKQGVSKRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPEspecificaciones
NP_001191 | |
Liquid | |
650 | |
BMP2 (Human) Recombinant Protein (Q03) | |
25 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
BMP2A | |
BMP2 | |
Yes | |
wheat germ expression system |
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
36.74kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue | |
AHLEEKQGVSKRHVRISRSLHQDEHSWSQIRPLLVTFGHDGKGHPLHKREKRQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECP | |
RUO | |
BMP2 | |
Wheat Germ (in vitro) | |
GST |