missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ATP2B4 Partial ORF (NP_001675, 1 a.a. - 92 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

341.70€ - 518.16€

Especificaciones

Nombre ATP2B4 (Human) Recombinant Protein (Q01)
Recombinante Yes
Para utilizar con (aplicación) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Peso molecular 35.86kDa
Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Ver más especificaciones

Productos 2
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
16102031
Ver documentos Detalles de la promoción
Abnova™
H00000493-Q01.10UG
10 ug
341.70€
10 microgramos
Ver productos alternativos
Ahorre hasta 
»
Envío estimado: 15-02-2022
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
16112031
Ver documentos Detalles de la promoción
Abnova™
H00000493-Q01.25UG
25 ug
518.16€
25 microgramos
Ver productos alternativos
Ahorre hasta 
»
Envío estimado: 15-02-2022
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

The protein encoded by this gene belongs to the family of P-type primary ion transport ATPases characterized by the formation of an aspartyl phosphate intermediate during the reaction cycle. These enzymes remove bivalent calcium ions from eukaryotic cells against very large concentration gradients and play a critical role in intracellular calcium homeostasis. The mammalian plasma membrane calcium ATPase isoforms are encoded by at least four separate genes and the diversity of these enzymes is further increased by alternative splicing of transcripts. The expression of different isoforms and splice variants is regulated in a developmental, tissue- and cell type-specific manner, suggesting that these pumps are functionally adapted to the physiological needs of particular cells and tissues. This gene encodes the plasma membrane calcium ATPase isoform 4. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Sequence: MTNPSDRVLPANSMAESREGDFGCTVMELRKLMELRSRDALTQINVHYGGVQNLCSRLKTSPVEGLSGNPADLEKRRQVFGHNVIPPKKPKT
Especificaciones

Especificaciones

ATP2B4 (Human) Recombinant Protein (Q01)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
35.86kDa
SDS
Product Certifications