missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ATOX1 Partial ORF (NP_004036, 1 a.a. - 68 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00000475-Q01.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome. [provided by RefSeq]
Sequence: MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLEEspecificaciones
| NP_004036 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 33.22kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE | |
| RUO | |
| ATOX1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 475 | |
| ATOX1 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| ATX1/HAH1/MGC138453/MGC138455 | |
| ATOX1 | |
| Recombinant | |
| wheat germ expression system |