Learn More
Abnova™ Human ARX Partial ORF (NP_620689, 159 a.a. - 264 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00170302-Q02.10ug
Detalles adicionales : Peso : 0.02000kg
Descripción
This gene is a homeobox-containing gene expressed during development. The expressed protein contains two conserved domains, a C-peptide (or aristaless domain) and the prd-like class homeobox domain. It is a member of the group-II aristaless-related protein family whose members are expressed primarily in the central and/or peripheral nervous system. This gene is thought to be involved in CNS development. Mutations in this gene cause X-linked mental retardation and epilepsy. [provided by RefSeq]
Sequence: LKISQAPQVSISRSKSYRENGAPFVPPPPALDELGGPGGVTHPEERLGVAGGPGSAPAAGGGTGTEDDEEELLEDEEDEDEEEELLEDDEEELLEDDARALLKEPREspecificaciones
NP_620689 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
37.29kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue | |
LKISQAPQVSISRSKSYRENGAPFVPPPPALDELGGPGGVTHPEERLGVAGGPGSAPAAGGGTGTEDDEEELLEDEEDEDEEEELLEDDEEELLEDDARALLKEPR | |
RUO | |
ARX | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
170302 | |
ARX (Human) Recombinant Protein | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
ISSX/MRX29/MRX32/MRX33/MRX36/MRX38/MRX43/MRX54/MRX76/MRX87/MRXS1/PRTS | |
ARX | |
Recombinant | |
wheat germ expression system |