missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ARL4A Full-length ORF (AAH01111, 1 a.a. - 200 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00010124-P01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16164522

  • 335.00€ / 10 microgramos
Fecha estimada de envío: 24-05-2024
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

ADP-ribosylation factor-like 4A is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4A is similar to ARL4C and ARL4D and each has a nuclear localization signal and an unusually high guaninine nucleotide exchange rate. ARL4A is located in both the nuclear and extranuclear cell compartments. Multiple transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Sequence: MGNGLSDQTSILSNLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR
Especificaciones

Especificaciones

AAH01111
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
47.74kDa
Glutathione Sepharose 4 Fast Flow
10 ug
RUO
ARL4A
Wheat Germ (in vitro)
GST
Liquid
Antibody Production, Protein Array, ELISA, Western Blot
10124
ARL4A (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ARL4
ARL4A
Recombinant
wheat germ expression system
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales