missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human ARL4A Full-length ORF (AAH01111, 1 a.a. - 200 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

335.00€ - 508.00€

Especificaciones

Número de acceso AAH01111
Para utilizar con (aplicación) Antibody Production, Protein Array, ELISA, Western Blot
Formulación 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
ID de gen (Entrez) 10124
Peso molecular 47.74kDa
Ver más especificaciones

Productos 2
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
16174522
Ver documentos Detalles de la promoción
Abnova™
H00010124-P01.25UG
25 ug
508.00€
25 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 02-07-2024
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
16164522
Ver documentos Detalles de la promoción
Abnova™
H00010124-P01.10UG
10 ug
335.00€
10 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 02-07-2024
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

ADP-ribosylation factor-like 4A is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL4A is similar to ARL4C and ARL4D and each has a nuclear localization signal and an unusually high guaninine nucleotide exchange rate. ARL4A is located in both the nuclear and extranuclear cell compartments. Multiple transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Sequence: MGNGLSDQTSILSNLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR
Especificaciones

Especificaciones

AAH01111
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
47.74kDa
Glutathione Sepharose 4 Fast Flow
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ARL4
ARL4A
Recombinant
wheat germ expression system
Antibody Production, Protein Array, ELISA, Western Blot
10124
ARL4A (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
RUO
ARL4A
Wheat Germ (in vitro)
GST
Liquid
Videos
SDS
Documentos

Documentos

Product Certifications