missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ALG12 Partial ORF (NP_077010, 369 a.a. - 425 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00079087-Q01.10ug
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
This gene encodes a member of the glycosyltransferase 22 family. The encoded protein catalyzes the addition of the eighth mannose residue in an alpha-1,6 linkage onto the dolichol-PP-oligosaccharide precursor (dolichol-PP-Man(7)GlcNAc(2)) required for protein glycosylation. Mutations in this gene have been associated with congenital disorder of glycosylation type Ig (CDG-Ig)characterized by abnormal N-glycosylation. [provided by RefSeq]
Sequence: NYPGGVAMQRLHQLVPPQTDVLLHIDVAAAQTGVSRFLQVNSAWRYDKREDVQPGTGEspecificaciones
| NP_077010 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 32.01kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| NYPGGVAMQRLHQLVPPQTDVLLHIDVAAAQTGVSRFLQVNSAWRYDKREDVQPGTG | |
| RUO | |
| ALG12 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 79087 | |
| ALG12 (Human) Recombinant Protein (Q01) | |
| 10 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| ECM39/MGC111358/MGC3136/PP14673/hALG12 | |
| ALG12 | |
| Recombinant | |
| wheat germ expression system |