Abnova™ FKBP5 (Human) Recombinant Protein

Name: Abnova&trade; FKBP5 (Human) Recombinant Protein
Brand: Abnova&trade;
SKU: 16185021
Price: 335.00 EUR

Human FKBP5 full-length ORF ( AAH42605, 1 a.a. - 457 a.a.) recombinant protein with GST-tag at N-terminal.

Marca: Abnova™ H00002289-P01.10ug

Detalles adicionales : Peso : 0.00010kg

Código de producto. 16185021

Fecha estimada de envío: 12-06-2024
para ver el stock

Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Descripción

Sequence: MTTDEGAKNNEESPTATVAEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGEDLFEDGGIIRRTKRKGEGYSNPNEGATVEIHLEGRCGGRMFDCRDVAFTVGEGEDHDIPIGIDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDTKEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFEKVLEVNPQNKAARLQISMCQKKAKEHNERDRRIYANMFKKFAEQDAKEEANKAMGKKTSEGVTNEKGTDSQAMEEEKPEGHV

Especificaciones

Número de acceso	AAH42605
Nombre	FK506 binding protein 5
Pruebas de control de calidad	125% SDS-PAGE Stained with Coomassie Blue
Requisitos de almacenamiento	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Símbolo de gen	FKBP5
Etiqueta de proteína	GST

ID de gen (Entrez)	2289
Método de preparación	Wheat germ expression system
Cantidad	10 μg
Alias de gen	FKBP51, FKBP54, MGC111006, P54, PPIase, Ptg-10
Especie	Wheat Germ (in vitro)
Tampón	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Sugerencias de productos

Descripción