missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ EDN3 (Human) Recombinant Protein

Human EDN3 full-length ORF ( AAH08876, 1 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal.

341.70€ - 518.16€

Especificaciones

Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ID de gen (Entrez) 1908
Ver más especificaciones

Productos 2
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
16104351
Ver documentos Detalles de la promoción
Abnova™
H00001908-P01.10UG
10 μg
341.70€
10 microgramos
Ver productos alternativos
Ahorre hasta 
»
Envío estimado: 15-03-2022
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
16114351
Ver documentos Detalles de la promoción
Abnova™
H00001908-P01.25UG
25 μg
518.16€
25 microgramos
Ver productos alternativos
Ahorre hasta 
»
Envío estimado: 15-03-2022
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

  • Sequence: MEPGLWLLFGLTVTSAAGFVPCSQSGDAGRRGVSQAPTAARSEGDCEETVAGPGEETVAGPGEGTVAPTALQGPSPGSPGQEQAAEGAPEHHRSRRCTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFRGKRSAGPLPGNLQLSHRPHLRCACVGRYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVEVKDQQSKQALDLHHPKLMPGSGLALAPSTCPRCLFQEGAP
Especificaciones

Especificaciones

Store at -80°C. Aliquot to avoid repeated freezing and thawing.
1908
SDS
Product Certifications