missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ CYB5 (Human) Recombinant Protein
Human CYB5 full-length ORF ( AAH15182, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.
Marca: Abnova™ H00001528-P01.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
- Sequence: MAEQSDEAVKYYTLEEIQKHNHSKSTWLILHHKVYDLTKFLEEHPGGEEVLREQAGGDATENFEDVGHSTDAREMSKTFIIGELHPDDRPKLNKPPETLITTIDSSSSWWTNWVIPAISAVAVALMYRLYMAED
Especificaciones
| AAH15182 | |
| cytochrome b5 type A (microsomal) | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| CYB5A | |
| GST |
| 1528 | |
| Wheat germ expression system | |
| 25 μg | |
| CYB5, MCB5 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |