missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CETN2 (Human) Recombinant Protein

Human CETN2 full-length ORF ( AAH05334, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00001069-P01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16103131

  • 508.00€ / 25 microgramos
Envío estimado: 30-12-2021

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

  • Sequence: MASNFKKANMASSSQRKRMSPKPELTEEQKQEIREAFDLFDADGTGTIDVKELKVAMRALGFEPKKEEIKKMISEIDKEGTGKMNFGDFLTVMTQKMSEKDTKEEILKAFKLFDDDETGKISFKNLKRVAKELGENLTDEELQEMIDEADRDGDGEVSEQEFLRIMKKTSLY
Especificaciones

Especificaciones

AAH05334
centrin, EF-hand protein, 2
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
CETN2
GST
1069
Wheat germ expression system
25 μg
CALT, CEN2
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales