missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CD24 (Human) Recombinant Protein

Human CD24 full-length ORF ( AAH07674, 28 a.a. - 80 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00000934-P01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16192821

  • 467.00€ / 25 microgramos


Fecha estimada de envío
23-02-2021
Añadir a la cesta

Descripción

Descripción

  • Sequence: ETTTGTSSNSSQSTSNSGLAPNPTNATTKAAGGALQSTASLFVVSLSLLHLYS
Especificaciones

Especificaciones

AAH07674
Wheat germ expression system
25 μg
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
934
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
GST
Videos
SDS
Documentos