missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ CCNC (Human) Recombinant Protein

Human CCNC full-length ORF ( AAH56153, 1 a.a. - 283 a.a.) recombinant protein with GST-tag at N-terminal.

341.70€ - 518.16€

Especificaciones

Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
ID de gen (Entrez) 892
Ver más especificaciones

Productos 2
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
16102721
Ver documentos Detalles de la promoción
Abnova™
H00000892-P01.10UG
10 μg
341.70€
10 microgramos
Ver productos alternativos
Ahorre hasta 
»
Envío estimado: 22-02-2022
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
16112721
Ver documentos Detalles de la promoción
Abnova™
H00000892-P01.25UG
25 μg
518.16€
25 microgramos
Ver productos alternativos
Ahorre hasta 
»
Envío estimado: 22-02-2022
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

  • Sequence: MAGNFWQSSHYLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLIAAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS
Especificaciones

Especificaciones

Store at -80°C. Aliquot to avoid repeated freezing and thawing.
892
SDS
Product Certifications