missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ BIK (Human) Recombinant Protein

Human BIK full-length ORF ( AAH01599, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal.

Marca:  Abnova™ H00000638-P01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16165224

  • 508.00€ / 25 microgramos
Fecha estimada de envío: 17-07-2024
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

  • Sequence: MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK
Especificaciones

Especificaciones

AAH01599
BCL2-interacting killer (apoptosis-inducing)
125% SDS-PAGE Stained with Coomassie Blue
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BIK
GST
638
Wheat germ expression system
25 μg
BIP1, BP4, NBK
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales