missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ BIK (Human) Recombinant Protein
Human BIK full-length ORF ( AAH01599, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal.
en la oferta
Especificaciones
Número de acceso | AAH01599 |
---|---|
ID de gen (Entrez) | 638 |
Nombre | BCL2-interacting killer (apoptosis-inducing) |
Método de preparación | Wheat germ expression system |
Pruebas de control de calidad | 125% SDS-PAGE Stained with Coomassie Blue |
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
---|---|---|---|---|---|---|---|---|---|
Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
16155224
|
Abnova™
H00000638-P01.10UG |
10 μg |
en la oferta
10 microgramos |
N/A | Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
Este artículo requiere una actualización de precios antes de ser solicitado. Solicite el precio de este artículo aquí. |
|||||||||
16165224
|
Abnova™
H00000638-P01.25UG |
25 μg |
en la oferta
25 microgramos |
N/A | Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
Este artículo requiere una actualización de precios antes de ser solicitado. Solicite el precio de este artículo aquí. |
|||||||||
Descripción
- Sequence: MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK
Especificaciones
AAH01599 | |
BCL2-interacting killer (apoptosis-inducing) | |
125% SDS-PAGE Stained with Coomassie Blue | |
BIP1, BP4, NBK | |
Wheat Germ (in vitro) | |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
638 | |
Wheat germ expression system | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
BIK | |
GST |