missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ BIK (Human) Recombinant Protein

Human BIK full-length ORF ( AAH01599, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal.

335.00€ - 508.00€

Especificaciones

Número de acceso AAH01599
ID de gen (Entrez) 638
Nombre BCL2-interacting killer (apoptosis-inducing)
Método de preparación Wheat germ expression system
Pruebas de control de calidad 125% SDS-PAGE Stained with Coomassie Blue
Ver más especificaciones

Productos 2
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
Código de producto Marca Cantidad Precio Cantidad y disponibilidad  
16155224
Ver documentos Detalles de la promoción
Abnova™
H00000638-P01.10UG
10 μg
335.00€
10 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 21-08-2024
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
16165224
Ver documentos Detalles de la promoción
Abnova™
H00000638-P01.25UG
25 μg
508.00€
25 microgramos
Ver productos alternativos
Ahorre hasta 
»
Fecha estimada de envío: 21-08-2024
para ver el stock
Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Descripción

Descripción

  • Sequence: MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK
Especificaciones

Especificaciones

AAH01599
BCL2-interacting killer (apoptosis-inducing)
125% SDS-PAGE Stained with Coomassie Blue
BIP1, BP4, NBK
Wheat Germ (in vitro)
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer
638
Wheat germ expression system
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
BIK
GST
Videos
SDS
Documentos

Documentos

Product Certifications