Abnova™ BIK (Human) Recombinant Protein

Human BIK full-length ORF ( AAH01599, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal.

335.00€ - 508.00€

Número de acceso	AAH01599
ID de gen (Entrez)	638
Nombre	BCL2-interacting killer (apoptosis-inducing)
Método de preparación	Wheat germ expression system
Pruebas de control de calidad	125% SDS-PAGE Stained with Coomassie Blue

Ver más especificaciones

Productos 2

Código de producto	Marca	Cantidad	Precio	Cantidad y disponibilidad
Código de producto	Marca	Cantidad	Precio	Cantidad y disponibilidad
16155224 Ver documentos Detalles de la promoción missing translation for 'viewProductCertificates'	Abnova™ H00000638-P01.10ug	10 μg	335.00€ 10 microgramos Ver productos alternativos Ahorre hasta »		Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

16165224 Ver documentos Detalles de la promoción missing translation for 'viewProductCertificates'	Abnova™ H00000638-P01.25ug	25 μg	508.00€ 25 microgramos Ver productos alternativos Ahorre hasta »		Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Descripción

Sequence: MSEVRPLSRDILMETLLYEQLLEPPTMEVLGMTDSEEDLDPMEDFDSLECMEGSDALALRLACIGDEMDVSLRAPRLAQLSEVAMHSLGLAFIYDQTEDIRDVLRSFMDGFTTLKENIMRFWRSPNPGSWVSCEQVLLALLLLLALLLPLLSGGLHLLLK

Especificaciones

Número de acceso	AAH01599
Nombre	BCL2-interacting killer (apoptosis-inducing)
Pruebas de control de calidad	125% SDS-PAGE Stained with Coomassie Blue
Alias de gen	BIP1, BP4, NBK
Especie	Wheat Germ (in vitro)
Tampón	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

ID de gen (Entrez)	638
Método de preparación	Wheat germ expression system
Requisitos de almacenamiento	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Símbolo de gen	BIK
Etiqueta de proteína	GST

Seguridad y manipulación

missing translation for 'shelfLife' : Best use within three months from the date of receipt of this protein

Descripción