Abnova™ AP2S1 (Human) Recombinant Protein

Human AP2S1 full-length ORF ( AAH06337, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.

Número de acceso	AAH06337
ID de gen (Entrez)	1175
Nombre	adaptor-related protein complex 2, sigma 1 subunit
Método de preparación	Wheat germ expression system
Pruebas de control de calidad	125% SDS-PAGE Stained with Coomassie Blue

Ver más especificaciones

Productos 2

Código de producto	Marca	Cantidad	Precio	Cantidad y disponibilidad
Código de producto	Marca	Cantidad	Precio	Cantidad y disponibilidad
16103271 Ver documentos Detalles de la promoción missing translation for 'viewProductCertificates'	Abnova™ H00001175-P01.10ug	10 μg	N/A Ver productos alternativos Ahorre hasta »	N/A

16113271 Ver documentos Detalles de la promoción missing translation for 'viewProductCertificates'	Abnova™ H00001175-P01.25ug	25 μg	N/A Ver productos alternativos Ahorre hasta »	N/A

Descripción

Sequence: MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE

Especificaciones

Número de acceso	AAH06337
Nombre	adaptor-related protein complex 2, sigma 1 subunit
Pruebas de control de calidad	125% SDS-PAGE Stained with Coomassie Blue
Alias de gen	AP17, AP17-DELTA, CLAPS2
Especie	Wheat Germ (in vitro)
Tampón	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

ID de gen (Entrez)	1175
Método de preparación	Wheat germ expression system
Requisitos de almacenamiento	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Símbolo de gen	AP2S1
Etiqueta de proteína	GST

Seguridad y manipulación

missing translation for 'shelfLife' : Best use within three months from the date of receipt of this protein

Haut de la page

Descripción