missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ AP2S1 (Human) Recombinant Protein
Human AP2S1 full-length ORF ( AAH06337, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.
en la oferta
Specifications
| Número de acceso | AAH06337 |
|---|---|
| ID de gen (Entrez) | 1175 |
| Nombre | adaptor-related protein complex 2, sigma 1 subunit |
| Método de preparación | Wheat germ expression system |
| Pruebas de control de calidad | 125% SDS-PAGE Stained with Coomassie Blue |
| Product Code | Brand | Cantidad | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Cantidad | Price | Quantity & Availability | |||||
|
16103271
|
Abnova™
H00001175-P01.10UG |
10 μg |
en la oferta
10 microgramos |
N/A | Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
|
Este artículo requiere una actualización de precios antes de ser solicitado. Solicite el precio de este artículo aquí. |
|||||||||
|
16113271
|
Abnova™
H00001175-P01.25UG |
25 μg |
en la oferta
25 microgramos |
N/A | Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
|
Este artículo requiere una actualización de precios antes de ser solicitado. Solicite el precio de este artículo aquí. |
|||||||||
Description
- Sequence: MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Specifications
| AAH06337 | |
| adaptor-related protein complex 2, sigma 1 subunit | |
| 125% SDS-PAGE Stained with Coomassie Blue | |
| AP17, AP17-DELTA, CLAPS2 | |
| Wheat Germ (in vitro) | |
| 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer |
| 1175 | |
| Wheat germ expression system | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| AP2S1 | |
| GST |