Abnova™ AP2S1 (Human) Recombinant Protein

Name: Abnova&trade; AP2S1 (Human) Recombinant Protein
Brand: Abnova&trade;
SKU: 16103271

Human AP2S1 full-length ORF ( AAH06337, 1 a.a. - 142 a.a.) recombinant protein with GST-tag at N-terminal.

Marca: Abnova™ H00001175-P01.10ug

Detalles adicionales : Peso : 0.00010kg

Código de producto. 16103271

Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo requiere una actualización de precios antes de ser solicitado.

Solicite el precio de este artículo aquí.

Descrizione

Sequence: MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE

Specifica

Número de acceso	AAH06337
Nombre	adaptor-related protein complex 2, sigma 1 subunit
Pruebas de control de calidad	125% SDS-PAGE Stained with Coomassie Blue
Requisitos de almacenamiento	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Símbolo de gen	AP2S1
Etiqueta de proteína	GST

ID de gen (Entrez)	1175
Método de preparación	Wheat germ expression system
Cantidad	10 μg
Alias de gen	AP17, AP17-DELTA, CLAPS2
Especie	Wheat Germ (in vitro)
Tampón	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer

Suggerimenti di prodotto

Descrizione