missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ TXNDC9 Recombinant Protein

Marca:  Abnova™ H00010190-P01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16164612

  • 508.00€ / 25 microgramos
Fecha estimada de envío: 25-06-2024
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Especificaciones

Especificaciones

AAH05968
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
50.6
8
Glutathione Sepharose 4 Fast Flow
25 ug
MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQQKQEWLSKGHGEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRHLAILSKKHLETKFLKLNVEKAPFLCERLHIKVIPTLALLKDGKTQDYVVGFTDLGNTDDFTTETLEWRLGSSDILNYSGNLMEPPFQNQKKFGTNFTKLEKKTIRGKKYDSDSDDD
APACD
TXNDC9
Wheat Germ (in vitro)
GST
Antibody Production, Protein Array, ELISA, Western Blot
10190
TXNDC9 (Human) Recombinant Protein (P01)
In vitro wheat germ expression system
12.5% SDS-PAGE Stained with Coomassie Blue.
Wheat Germ (in vitro)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
TXNDC9
Human
Recombinant
Solution
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales