missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ TXNDC9 Recombinant Protein
Marca: Abnova™ H00010190-P01.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Especificaciones
| AAH05968 | |
| Solution | |
| 10190 | |
| TXNDC9 (Human) Recombinant Protein (P01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| TXNDC9 | |
| Human | |
| Yes |
| Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 50.6 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| 25 ug | |
| MEADASVDMFSKVLEHQLLQTTKLVEEHLDSEIQKLDQMDEDELERLKEKRLQALRKAQQQKQEWLSKGHGEYREIPSERDFFQEVKESENVVCHFYRDSTFRCKILDRHLAILSKKHLETKFLKLNVEKAPFLCERLHIKVIPTLALLKDGKTQDYVVGFTDLGNTDDFTTETLEWRLGSSDILNYSGNLMEPPFQNQKKFGTNFTKLEKKTIRGKKYDSDSDDD | |
| APACD | |
| TXNDC9 | |
| Wheat Germ (in vitro) | |
| GST |