Learn More
Abnova™ TNF Recombinant Protein
Human TNF full-length ORF recombinant protein with GST-tag at N-terminal
Marca: Abnova™ H00007124-P01.25ug
Descripción
This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. This cytokine is mainly secreted by macrophages. It can bind to, and thus functions through its receptors TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. This cytokine is involved in the regulation of a wide spectrum of biological processes including cell proliferation, differentiation, apoptosis, lipid metabolism, and coagulation. This cytokine has been implicated in a variety of diseases, including autoimmune diseases, insulin resistance, and cancer. Knockout studies in mice also suggested the neuroprotective function of this cytokine.
- Molecular Weight: 51.37kDa
- Preparation Method: in vitro wheat germ expression system
- Purification: Glutathione Sepharose 4 Fast Flow
- Storage Buffer: 50mM Tris-HCI, 10mM reduced Glutathione, pH 8.0 in the elution buffer
Sequence: MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWY
EPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL
Best when used within three months from the date of receipt.
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Especificaciones
AAH28148 | |
50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
51.37 | |
8 | |
Glutathione Sepharose 4 Fast Flow | |
25 ug | |
MSTESMIRDVELAEEALPKKTGGPQGSRRCLFLSLFSFLIVAGATTLFCLLHFGVIGPQREEFPRDLSLISPLAQAVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL | |
DIF/TNF-alpha/TNFA/TNFSF2 | |
TNF | |
Wheat Germ (in vitro) | |
GST |
Antibody Production, Protein Array, ELISA, Western Blot | |
7124 | |
TNF (Human) Recombinant Protein (P01) | |
In vitro wheat germ expression system | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
Wheat Germ (in vitro) | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
TNF | |
Human | |
Recombinant | |
Solution |