Abnova™ SCAMP2 Recombinant Protein

en la oferta

Número de acceso	AAH01376
Para utilizar con (aplicación)	Antibody Production, Protein Array, ELISA, Western Blot
Formulación	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
ID de gen (Entrez)	10066
Peso molecular	61.93

Ver más especificaciones

Productos 2

Código de producto	Marca	Cantidad	Precio	Cantidad y disponibilidad
Código de producto	Marca	Cantidad	Precio	Cantidad y disponibilidad
16194442 Ver documentos Detalles de la promoción missing translation for 'viewProductCertificates'	Abnova™ H00010066-P01.10UG	10 ug	en la oferta 10 microgramos Ver productos alternativos Ahorre hasta »	N/A	Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Este artículo requiere una actualización de precios antes de ser solicitado. Solicite el precio de este artículo aquí.


16104452 Ver documentos Detalles de la promoción missing translation for 'viewProductCertificates'	Abnova™ H00010066-P01.25UG	25 ug	en la oferta 25 microgramos Ver productos alternativos Ahorre hasta »	N/A	Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.
Este artículo requiere una actualización de precios antes de ser solicitado. Solicite el precio de este artículo aquí.

Descripción

ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array

Especificaciones

Número de acceso	AAH01376
Formulación	50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer
Peso molecular	61.93
Intervalo de pH	8
Método de purificación	Glutathione Sepharose 4 Fast Flow
Fuente	Wheat Germ (in vitro)
Requisitos de almacenamiento	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Símbolo de gen	SCAMP2
Especie	Wheat Germ (in vitro)
Etiqueta de proteína	GST

Para utilizar con (aplicación)	Antibody Production, Protein Array, ELISA, Western Blot
ID de gen (Entrez)	10066
Nombre	SCAMP2 (Human) Recombinant Protein (P01)
Método de preparación	In vitro wheat germ expression system
Pruebas de control de calidad	12.5% SDS-PAGE Stained with Coomassie Blue.
Inmunógeno	MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQPAVLQPSVEPTQPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHVRQNNWPPLPSWCPVKPCFYQDFSTEIPADYQRICKMLYYLWMLHSVTLFLNLLACLAWFSGNSSKGVDFGLSILWFLIFTPCAFLCWYRPIYKAFRSDNSFSFFVFFFVFFCQIGIYIIQLVGIPGLGDSGWIAALSTLDNHSLAISVIMMVVAGFFTLCAVLSVFLLQRVHSLYRRTGASFQQAQEEFSQGIFSSRTFHRAASSAAQGAFQGN
Nombre común	SCAMP2
Reactividad cruzada	Human
Recombinante	Recombinant
Formulario	Solution

Descripción