missing translation for 'onlineSavingsMsg'
Learn More
Learn More
RXFP2 Polyclonal Antibody, Invitrogen™
Rabbit Polyclonal Antibody
Marca: Thermo Scientific PA595582
Detalles adicionales : Peso : 0.01000kg
Descripción
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
The activity of this relaxin receptor is mediated by G proteins leading to stimulation of adenylate cyclase and an increase of cAMP and may also be a receptor for Leydig insulin-like peptide. Expressed in embryonic and adult gonads of males and females, as well in male gubernarculum and in brain. Not detected in kidney, spleen and heart.Especificaciones
| RXFP2 | |
| Polyclonal | |
| Unconjugated | |
| RXFP2 | |
| G protein coupled receptor affecting testicular descent, G protein-coupled receptor 106, Gpcr, GPR106, G-protein coupled receptor 106, G-protein coupled receptor affecting testicular descent, GREAT, INSL3 receptor, INSL3R, leucine-rich repeat-containing G protein-coupled receptor 8, leucine-rich repeat-containing G-protein coupled receptor 8, Lgr8, LGR8.1, Relaxin family peptide receptor 2, relaxin receptor 2, relaxin/insulin like family peptide receptor 2, relaxin/insulin-like family peptide receptor 2, Rxfp2, RXFPR2 | |
| Rabbit | |
| Affinity chromatography | |
| RUO | |
| 122042 | |
| Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. | |
| Lyophilized |
| Flow Cytometry, Western Blot | |
| 500 μg/mL | |
| PBS with 4MG trehalose and 0.05MG sodium azide | |
| Q8WXD0 | |
| RXFP2 | |
| A synthetic peptide corresponding to a sequence of human GPCR LGR8 (MIVFLVFKHLFSLRLITMFFLLHFIVLINVKDFALTQ). | |
| 100 μg | |
| Primary | |
| Human | |
| Antibody | |
| IgG |