missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant Rat CNTF Protein
A cDNA sequence encoding the CNTF was constructed and used to recombinantly synthesize the protein.
Especificaciones
| Nombre | CNTF Protein |
|---|---|
| Estado normativo | Research Use Only |
| Concentración de endotoxinas | < 1.0 EU per ug protein as determined by the LAL method. |
| Actividad biológica | Fully biologically active by its ability to phosphorylate STAT3 in several cells lines. |
| Tipo de producto | Recombinant Protein |
Especificaciones
| CNTF Protein | |
| < 1.0 EU per ug protein as determined by the LAL method. | |
| Recombinant Protein | |
| E. coli | |
| AFAEQTPLTL HRRDLSSRSIWLARKIRSDLTALMESYVKHQGLNKNINLDSVDGVPVASTDRWSEMTEAERLQENLQAYRTFQGMLTKLLEDQRVHFTPTEGDFHQAIHTLMLQVSAFAYQLEELMVLLEQKIPENEADGMPATVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRVISSHQMGISALESHYGAKDKQM | |
| Greater than 99.0% as determined by:(a) Analysis by Gel Filtration. (b) Analysis by SDS-PAGE. |
| Research Use Only | |
| Fully biologically active by its ability to phosphorylate STAT3 in several cells lines. | |
| Rat | |
| Untagged | |
| Lyophilized from a concentrated (1 mg/ml) solution in water containing 0.025% NaHCO3. |