missing translation for 'onlineSavingsMsg'
Learn More
Learn More
enQuireBio™ Recombinant HPV HPV 11 Protein
A cDNA sequence encoding the HPV 11 was constructed and used to recombinantly synthesize the protein.
Marca: enQuireBio™ QP12306-100ug
Este artículo no se puede devolver.
Vea la política de devoluciones
Especificaciones
HPV HPV 11 Protein | |
Research Use Only | |
Recombinant Protein | |
E. coli | |
VDKLWRPSDSTVYVPPPNPVSKVVATDAYVKRTNIFYHASSSRLLAVGHPYYSIKKVNKTVVPKVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPLLNKYDDVENSGGYGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGTQCSNTSVQNGDCPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPLDICGTVCKYPDYLQMAADPYGDRLFFYLRKEQMFARHFFNRAGTVGEPVPDDLLVKGGNNRSSVASSIYVHTPSGSLVSSEAQLFNKPYWLQKAQGHNNGICWGNHLFVTVVDTTRSTNMTLCASVSKSATYTNSDYKEYMRHVEEFDLQFIFQLCSITLSAEVMAYIHTMNPSVLEDWNFGLSPPPNGTLEDTYRYVQSQAITCQKPTPEKEKQDPYKDMSFWEVNLKEKFSSELDQFPLGRKFLLQSGYRGRTSARTGIKRPAVSKPSTAPKRKRTKTKKKFGTKLSR | |
Protein is >90% pure as determined by 10% PAGE (coomassie staining). |
100 μg | |
Not Determined. Testing recommended prior to use in cell culture and can be performed upon request. | |
HPV | |
GST | |
Recombinant HPV11 solution in PBS, 3M Urea and 100mM arginine. |