missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ NXT1 Recombinant Protein
en la oferta
Especificaciones
| Número de acceso | AAH00759 |
|---|---|
| Para utilizar con (aplicación) | Antibody Production, Protein Array, ELISA, Western Blot |
| Formulación | 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer |
| ID de gen (Entrez) | 29107 |
| Peso molecular | 41.14 |
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|---|---|---|---|---|---|---|---|---|---|
| Código de producto | Marca | Cantidad | Precio | Cantidad y disponibilidad | |||||
|
16189022
|
Abnova™
H00029107-P01.10UG |
10 ug |
en la oferta
10 microgramos |
N/A | Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
|
Este artículo requiere una actualización de precios antes de ser solicitado. Solicite el precio de este artículo aquí. |
|||||||||
|
16199022
|
Abnova™
H00029107-P01.25UG |
25 ug |
en la oferta
25 microgramos |
N/A | Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo. | ||||
|
Este artículo requiere una actualización de precios antes de ser solicitado. Solicite el precio de este artículo aquí. |
|||||||||
Descripción
ELISA, Western Blotting (Recombinant Protein), Antibody Production, Protein Array
Especificaciones
| AAH00759 | |
| 50mM Tris HCl, 10mM reduced Glutathione, pH 8 in the Elution Buffer | |
| 41.14 | |
| 8 | |
| Glutathione Sepharose 4 Fast Flow | |
| Wheat Germ (in vitro) | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| NXT1 | |
| Human | |
| Recombinant | |
| Solution |
| Antibody Production, Protein Array, ELISA, Western Blot | |
| 29107 | |
| NXT1 (Human) Recombinant Protein (P01) | |
| In vitro wheat germ expression system | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MASVDFKTYVDQACRAAEEFVNVYYTTMDKRRRLLSRLYMGTATLVWNGNAVSGQESSSEFFEMLPSSEFQISVVDCQPVHDEATPSQTTVLVVICGSVKFEGNKQRDFNQNFILTAQASPSNTVWKIASDCFRFQDWAS | |
| MTR2/P15 | |
| NXT1 | |
| Wheat Germ (in vitro) | |
| GST |