missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. Novus Biologicals™ Shwachman Bodian-Diamond syndrome Protein

Novus Biologicals™ Shwachman Bodian-Diamond syndrome Protein

Código de producto. 18275154 Tienda Bio Techne Productos
Change view
Click to view available options
Cantidad:
0,1 mg
0,5 mg
Tamaño de la unidad:
0.10 miligramo
0.50 miligramo
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Código de producto. Cantidad unitSize
18275154 0,1 mg 0.10 miligramo
18265041 0,5 mg 0.50 miligramo
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Este artículo no se puede devolver. Vea la política de devoluciones
Código de producto. 18275154 Proveedor Novus Biologicals™ N.º de proveedor NBP1494500.1MG

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Highly purified. Generating reliable and reproducible results.

A recombinant protein with a N-Terminal His-tag and corresponding to the amino acids 1-250 of Human Shwachman Bodian-Diamond syndrome The Recombinant Human Shwachman Bodian-Diamond syndrome Protein is derived from E. coli. The Recombinant Human Shwachman Bodian-Diamond syndrome Protein has been validated for the following applications: SDS-Page.
TRUSTED_SUSTAINABILITY

Especificaciones

Concentración 0.5mg/mL
Para utilizar con (aplicación) ELISA, SDS-PAGE
Formulación 20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol, 2mM DTT, 50mM NaCl, 0.1mM EDTA
ID de gen (Entrez) 51119
Peso molecular 30.9kDa
Método de purificación Protein
Cantidad 0,1 mg
Fuente Human
Inmunógeno SBDS, 1-250aa. Sequence: MGSSHHHHHHSSGLVPRGSHMSIFTPTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVKTNKSTKQQALEVIKQLKEKMKIERAHMRLRFILPVNEGKKLKEKLKPLIKVIESEDYGQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLNLKDVEEGDEKFE
Requisitos de almacenamiento Store at -80°C. Avoid freeze-thaw cycles.
Estado normativo RUO
Nombre común Shwachman Bodian-Diamond syndrome
Conjugado Unconjugated
Grado de pureza o calidad >95%
Mostrar más Mostrar menos
Título del producto
Seleccione un problema

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.