Learn More
Invitrogen™ Human TOGARAM2 (aa 742-834) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP96223
Description
Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58006 (PA5-58006. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Specifications
Q6ZUX3 | |
Blocking Assay, Control | |
165186 | |
100 μL | |
Crescerin-2; FAM179A; family with sequence similarity 179 member A; family with sequence similarity 179, member A; protein FAM179A; TOG array regulator of axonemal microtubules protein 2; TOGARAM2 | |
TOGARAM2 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human TOGARAM2 (aa 742-834) Control Fragment | |
RUO | |
TOGARAM2 | |
Unconjugated | |
Recombinant | |
GLSCNGPRLVGLRSTLQGRGEMVEQLRELTRLLEAKDFRSRMEGVGQLLELCKAKTELVTAHLVQVFDAFTPRLQDSNKKVNQWALESFAKMI | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Your input is important to us. Please complete this form to provide feedback related to the content on this product.