missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human TIAM2 (aa 1562-1674) Control Fragment Recombinant Protein

Recombinant Protein

Marca:  Invitrogen™ RP90642

Código de producto. 30201524

  • 265.00€ / 100 microlitros

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Explore más ofertas especiales
Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Descripción

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53098 (PA5-53098. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Modulates the activity of RHO-like proteins and connects extracellular signals to cytoskeletal activities. Acts as a GDP- dissociation stimulator protein that stimulates the GDP-GTP exchange activity of RHO-like GTPases and activates them. Mediates extracellular laminin signals to activate Rac1, contributing to neurite growth. Involved in lamellipodial formation and advancement of the growth cone of embryonic hippocampal neurons. Promotes migration of neurons in the cerebral cortex. When overexpressed, induces membrane ruffling accompanied by the accumulation of actin filaments along the altered plasma membrane. Activates specifically RAC1, but not CDC42 and RHOA.
TRUSTED_SUSTAINABILITY
Especificaciones

Especificaciones

Q8IVF5
Blocking Assay, Control
26230
100 μL
3000002F19Rik; KIAA2016; mKIAA2016; RAS-related C3 botulinum substrate 1, guanine nucleotide exchange factor 1; SIF and TIAM1-like exchange factor; Stef; T cell lymphoma invasion and metastasis 2; T-cell lymphoma invasion and metastasis 2; T-cell lymphoma invasion and metastasis 2; RAS-related C3 botulinum substrate 1, guanine nucleotide exchange factor 1; TIAM2; TIAM-2; T-lymphoma invasion and metastasis-inducing protein 2
Tiam2
Human
His-ABP-tag
-20°C, Avoid Freeze/Thaw Cycles
Liquid
≥5.0 mg/mL
1 M urea, PBS with no preservative; pH 7.4
Human TIAM2 (aa 1562-1674) Control Fragment
RUO
TIAM2
Unconjugated
Recombinant
IKESDILSDEDDDHRQTVKQGSPTKDIEIQFQRLRISEDPDVHPEAEQQPGPESGEGQKGGEQPKLVRGHFCPIKRKANSTKRDRGTLLKAQIRHQSLDSQSENATIDLNSVL
E. coli
>80% by SDS-PAGE and Coomassie blue staining
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

One moment while we fetch your results.
Certificados
Ofertas especiales

Ofertas especiales

Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human TIAM2 (aa 1562-1674) Control Fragment Recombinant Protein > 100 μL; Unlabeled

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado