Learn More
Invitrogen™ Human TIAM2 (aa 1562-1674) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP90642
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53098 (PA5-53098. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Modulates the activity of RHO-like proteins and connects extracellular signals to cytoskeletal activities. Acts as a GDP- dissociation stimulator protein that stimulates the GDP-GTP exchange activity of RHO-like GTPases and activates them. Mediates extracellular laminin signals to activate Rac1, contributing to neurite growth. Involved in lamellipodial formation and advancement of the growth cone of embryonic hippocampal neurons. Promotes migration of neurons in the cerebral cortex. When overexpressed, induces membrane ruffling accompanied by the accumulation of actin filaments along the altered plasma membrane. Activates specifically RAC1, but not CDC42 and RHOA.
Especificaciones
Q8IVF5 | |
Blocking Assay, Control | |
26230 | |
100 μL | |
3000002F19Rik; KIAA2016; mKIAA2016; RAS-related C3 botulinum substrate 1, guanine nucleotide exchange factor 1; SIF and TIAM1-like exchange factor; Stef; T cell lymphoma invasion and metastasis 2; T-cell lymphoma invasion and metastasis 2; T-cell lymphoma invasion and metastasis 2; RAS-related C3 botulinum substrate 1, guanine nucleotide exchange factor 1; TIAM2; TIAM-2; T-lymphoma invasion and metastasis-inducing protein 2 | |
Tiam2 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human TIAM2 (aa 1562-1674) Control Fragment | |
RUO | |
TIAM2 | |
Unconjugated | |
Recombinant | |
IKESDILSDEDDDHRQTVKQGSPTKDIEIQFQRLRISEDPDVHPEAEQQPGPESGEGQKGGEQPKLVRGHFCPIKRKANSTKRDRGTLLKAQIRHQSLDSQSENATIDLNSVL | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.