missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SLC11A1 Full-length ORF (AAH41787.1, 1 a.a. - 178 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00006556-P01.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
This gene is a member of the solute carrier family 11 (proton-coupled divalent metal ion transporters) family and encodes a multi-pass membrane protein. The protein functions as a divalent transition metal (iron and manganese) transporter involved in iron metabolism and host resistance to certain pathogens. Mutations in this gene have been associated with susceptibility to infectious diseases such as tuberculosis and leprosy, and inflammatory diseases such as rheumatoid arthritis and Crohn disease. Alternatively spliced variants that encode different protein isoforms have been described but the full-length nature of only one has been determined. [provided by RefSeq]
Sequence: MTGDKGPQRLSGSSYGSISSPTSPTSPGPQQAPPRETYLRNIESDLQAGAVAGFKLLWVLLWATVLGLLCQRLAARLGVVTGKDLGEVCHLYYPKVPRTVLWLTIELAIVGSDMQEVIGTAIAFNLLSAGRYHPSVPQLFRPGREQLLLLPPLTSPSQSLFYPAVPSEAGLLPCFPEMEspecificaciones
| AAH41787.1 | |
| Liquid | |
| 6556 | |
| SLC11A1 (Human) Recombinant Protein (P01) | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| MTGDKGPQRLSGSSYGSISSPTSPTSPGPQQAPPRETYLRNIESDLQAGAVAGFKLLWVLLWATVLGLLCQRLAARLGVVTGKDLGEVCHLYYPKVPRTVLWLTIELAIVGSDMQEVIGTAIAFNLLSAGRYHPSVPQLFRPGREQLLLLPPLTSPSQSLFYPAVPSEAGLLPCFPEM | |
| RUO | |
| SLC11A1 | |
| Wheat Germ (in vitro) | |
| GST |
| Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 45.6kDa | |
| Glutathione Sepharose 4 Fast Flow | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| LSH/NRAMP/NRAMP1 | |
| SLC11A1 | |
| Yes | |
| wheat germ expression system |