missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human SH2D4A Partial ORF (AAH14525, 239 a.a. - 338 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Especificaciones
| Número de acceso | AAH14525 |
|---|---|
| Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| ID de gen (Entrez) | 63898 |
| Peso molecular | 36.63kDa |
Descripción
Sequence: KKANELLLSTGMPGSFLIRVSERIKGYALSYLSEDGCKHFLIDASADAYSFLGVDQLQHATLADLVEYHKEEPITSLGKELLLYPCGQQDQLPDYLELFEEspecificaciones
| AAH14525 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.63kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| FLJ20967/SH2A | |
| SH2D4A | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 63898 | |
| SH2D4A (Human) Recombinant Protein (Q01) | |
| KKANELLLSTGMPGSFLIRVSERIKGYALSYLSEDGCKHFLIDASADAYSFLGVDQLQHATLADLVEYHKEEPITSLGKELLLYPCGQQDQLPDYLELFE | |
| RUO | |
| SH2D4A | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |