missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human PCGF1 Full-length ORF (AAH04952.1, 1 a.a. - 247 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00084759-P01.10ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16166063

  • 335.00€ / 10 microgramos
Fecha estimada de envío: 02-04-2024
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

PCGF1 is a mammalian homolog of the Drosophila polycomb group genes, which act as transcriptional repressors to regulate anterior-posterior patterning in early embryonic development (Nunes et al., 2001 [PubMed 11287196]). See also PCGF2 (MIM 600346).[supplied by OMIM]

Sequence: MRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVKEKRR
Especificaciones

Especificaciones

AAH04952.1
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
55.6kDa
Glutathione Sepharose 4 Fast Flow
10 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
2010002K04Rik/FLJ43754/MGC10882/NSPC1/RNF3A-2/RNF68
PCGF1
Recombinant
wheat germ expression system
Antibody Production, Protein Array, ELISA, Western Blot
84759
PCGF1 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MRLRNQLQSVYKMDPLRNEEEVRVKIKDLNEHIVCCLCAGYFVDATTITECLHTFCKSCIVKYLQTSKYCPMCNIKIHETQPLLNLKLDRVMQDIVYKLVPGLQDSEEKRIREFYQSRGLDRVTQPTGEEPALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYVRCSVRAEVRHLRRVLCHRLMLNPQHVQLLFDNEVLPDHMTMKQIWLSRWFGKPSPLLLQYSVKEKRR
RUO
PCGF1
Wheat Germ (in vitro)
GST
Liquid
Recomendaciones

Recomendaciones

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales