Abnova™ Human ORF1-FL49 Full-length ORF (AAH13643, 1 a.a. - 97 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca: Abnova™ H00084418-P01.25ug

Código de producto. 16105883

Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Sequence: MNQENPPPYPGPGPTAPYPPYPPQPMGPGPMGGPYPPPQGYPYQGYPQYGWQGGPQEPPKTTVYVVEDQRRDELGPSTCLTACWTALCCCCLWDMLT

Especificaciones

Número de acceso	AAH13643
Formulación	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Peso molecular	36.41kDa
Método de purificación	Glutathione Sepharose 4 Fast Flow
Cantidad	25 ug
Requisitos de almacenamiento	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias de gen	ORF1-FL49
Símbolo de gen	C5orf32
Recombinante	Recombinant
Sistema de expresión	wheat germ expression system

Para utilizar con (aplicación)	Antibody Production, Protein Array, ELISA, Western Blot
ID de gen (Entrez)	84418
Nombre	ORF1-FL49 (Human) Recombinant Protein (P01)
Pruebas de control de calidad	12.5% SDS-PAGE Stained with Coomassie Blue.
Inmunógeno	MNQENPPPYPGPGPTAPYPPYPPQPMGPGPMGGPYPPPQGYPYQGYPQYGWQGGPQEPPKTTVYVVEDQRRDELGPSTCLTACWTALCCCCLWDMLT
Estado normativo	RUO
Nombre común	C5orf32
Especie	Wheat Germ (in vitro)
Etiqueta de proteína	GST
Formulario	Liquid

Sugerencias de productos

Descripción