missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human NXNL1 Full-length ORF (NP_612463.1, 1 a.a. - 212 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00115861-P01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16107273

  • 518.16€ / 25 microgramos
Envío estimado: 17-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

Sequence: MASLFSGRILIRNNSDQDELDTEAEVSRRLENRLVLLFFGAGACPQCQAFVPILKDFFVRLTDEFYVLRAAQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDDLRRDLGRQFSVERLPAVVVLKPDGDVLTRDGADEIQRLGTACFANWQEAAEVLDRNFQLPEDLEDQEPRSLTECLRRHKYRVEKAARGGRDPGGGGGEEGGAGGLF
Especificaciones

Especificaciones

NP_612463.1
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
50.3kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
RDCVF/TXNL6
NXNL1
Yes
wheat germ expression system
Liquid
115861
NXNL1 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MASLFSGRILIRNNSDQDELDTEAEVSRRLENRLVLLFFGAGACPQCQAFVPILKDFFVRLTDEFYVLRAAQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDDLRRDLGRQFSVERLPAVVVLKPDGDVLTRDGADEIQRLGTACFANWQEAAEVLDRNFQLPEDLEDQEPRSLTECLRRHKYRVEKAARGGRDPGGGGGEEGGAGGLF
RUO
NXNL1
Wheat Germ (in vitro)
GST
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales