Abnova™ Human NUCB2 Partial ORF (NP_005004.1, 322 a.a. - 420 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca: Abnova™ H00004925-Q01.25ug

Código de producto. 16102135

Por favor, inicie sesión para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Nucleobindin-2 is a calcium-binding EF-hand protein.[supplied by OMIM]

Sequence: TEKKEFLEPDSWETLDQQQFFTEEELKEYENIIALQENELKKKADELQKQKEELQRQHDQLEAQKLEYHQVIQQMEQKKLQQGIPPSGPAGELKFEPHI

Especificaciones

Número de acceso	NP_005004.1
Formulación	50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Peso molecular	36.63kDa
Pruebas de control de calidad	12.5% SDS-PAGE Stained with Coomassie Blue.
Inmunógeno	TEKKEFLEPDSWETLDQQQFFTEEELKEYENIIALQENELKKKADELQKQKEELQRQHDQLEAQKLEYHQVIQQMEQKKLQQGIPPSGPAGELKFEPHI
Estado normativo	RUO
Nombre común	NUCB2
Especie	Wheat Germ (in vitro)
Etiqueta de proteína	GST
Formulario	Liquid

Para utilizar con (aplicación)	Antibody Production, ELISA, Protein Array, Western Blot
ID de gen (Entrez)	4925
Nombre	NUCB2 (Human) Recombinant Protein (Q01)
Cantidad	25 ug
Requisitos de almacenamiento	Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Alias de gen	NEFA
Símbolo de gen	NUCB2
Recombinante	Recombinant
Sistema de expresión	wheat germ expression system

Sugerencias de productos

Descripción