missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human LMO1 Partial ORF (NP_002306, 1 a.a. - 90 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00004004-Q01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16107431

  • 518.16€ / 25 microgramos
Envío estimado: 26-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

LMO1 enocdes a cysteine-rich, two LIM domain transcriptional regulator. It is mapped to an area of consistent chromosomal translocation in chromosome 11, disrupting it in T-cell leukemia, although more rarely than the related gene, LMO2 is disrupted. [provided by RefSeq]

Sequence: MMVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAA
Especificaciones

Especificaciones

NP_002306
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
35.64kDa
12.5% SDS-PAGE Stained with Coomassie Blue.
MMVLDKEDGVPMLSVQPKGKQKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKANLILCRRDYLRLFGTTGNCAA
RUO
LMO1
Wheat Germ (in vitro)
GST
wheat germ expression system
Liquid
4004
LMO1 (Human) Recombinant Protein (Q01)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
MGC116692/RBTN1/RHOM1/TTG1
LMO1
Yes
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales