missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human HOXB7 Partial ORF (NP_004493, 55 a.a. - 120 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00003217-Q01.10ug
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
This gene is a member of the Antp homeobox family and encodes a protein with a homeobox DNA-binding domain. It is included in a cluster of homeobox B genes located on chromosome 17. The encoded nuclear protein functions as a sequence-specific transcription factor that is involved in cell proliferation and differentiation. Increased expression of this gene is associated with some cases of melanoma and ovarian carcinoma. [provided by RefSeq]
Sequence: MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAEspecificaciones
NP_004493 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
33kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA | |
RUO | |
HOXB7 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Antibody Production, ELISA, Protein Array, Western Blot | |
3217 | |
HOXB7 (Human) Recombinant Protein (Q01) | |
10 ug | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
HHO.C1/HOX2/HOX2C/Hox-2.3 | |
HOXB7 | |
Recombinant | |
wheat germ expression system |