missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human HNF1B Partial ORF (NP_000449.1, 173 a.a. - 277 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00006928-Q02.25ug

Detalles adicionales : Peso : 0.02000kg

 Ver más versiones de este producto

Código de producto. 16064825

  • 545.00€ / 25 microgramos
Fecha estimada de envío: 04-08-2022
para ver el stock

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

This gene encodes a member of the homeodomain-containing superfamily of transcription factors. The protein binds to DNA as either a homodimer, or a heterodimer with the related protein hepatocyte nuclear factor 1-alpha. The gene has been shown to function in nephron development, and regulates development of the embryonic pancreas. Mutations in this gene result in renal cysts and diabetes syndrome and noninsulin-dependent diabetes mellitus, and expression of this gene is altered in some types of cancer. Multiple transcript variants encoding different isoforms have been found for this gene

Sequence: VRKQREILRQFNQTVQSSGNMTDKSSQDQLLFLFPEFSQQSHGPGQSDDACSEPTNKKMRRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRG
Especificaciones

Especificaciones

NP_000449.1
Liquid
6928
HNF1B (Human) Recombinant Protein (Q02)
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
FJHN/HNF1beta/HNF2/HPC11/LF-B3/LFB3/MODY5/TCF2/VHNF1
HNF1B
Yes
wheat germ expression system
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
37.29kDa
12.5% SDS-PAGE Stained with Coomassie Blue
VRKQREILRQFNQTVQSSGNMTDKSSQDQLLFLFPEFSQQSHGPGQSDDACSEPTNKKMRRNRFKWGPASQQILYQAYDRQKNPSKEEREALVEECNRAECLQRG
RUO
HNF1B
Wheat Germ (in vitro)
GST
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales