missing translation for 'onlineSavingsMsg'
Learn More

Abnova™ Human hCG_2023776 Full-length ORF (XP_208373.5, 1 a.a. - 317 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Marca:  Abnova™ H00402562-P01.25ug

Detalles adicionales : Peso : 0.00010kg

 Ver más versiones de este producto

Código de producto. 16100664

  • 518.16€ / 25 microgramos
Envío estimado: 07-01-2022

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.


Descripción

Descripción

Sequence: MSKSESPKEPKQLRKLFIGGLSFETTNESLRSHFEQWGTLMDCVVMRDPNTKCSRGFGFVTYATVEEVDAAMNARPHKVDGRVVESKRAVSREDSQRPGAHLTVKKIFVGGIKEDTKEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHICEVRKALSKQEMASTSSSQRGQSGSGNFSGGRGGGFSGNDNFGHGGNFSGRGGFGGSRGAGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFRPMKGGNFGGRSSGPYGGGGNTLQNQGGYGSSSSSSSYGSGRRF
Especificaciones

Especificaciones

XP_208373.5
Antibody Production, Array, Enzyme-linked Immunoabsorbent Assay, Western Blot (Recombinant protein)
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
60.3kDa
Glutathione Sepharose 4 Fast Flow
25 ug
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
LOC402562
hCG_2023776
Yes
wheat germ expression system
Liquid
402562
hCG_2023776 (Human) Recombinant Protein (P01)
12.5% SDS-PAGE Stained with Coomassie Blue.
MSKSESPKEPKQLRKLFIGGLSFETTNESLRSHFEQWGTLMDCVVMRDPNTKCSRGFGFVTYATVEEVDAAMNARPHKVDGRVVESKRAVSREDSQRPGAHLTVKKIFVGGIKEDTKEHHLRDYFEQYGKIEVIEIMTDRGSGKKRGFAFVTFDDHDSVDKIVIQKYHTVNGHICEVRKALSKQEMASTSSSQRGQSGSGNFSGGRGGGFSGNDNFGHGGNFSGRGGFGGSRGAGGYGGSGDGYNGFGNDGSNFGGGGSYNDFGNYNNQSSNFRPMKGGNFGGRSSGPYGGGGNTLQNQGGYGSSSSSSSYGSGRRF
RUO
hCG_2023776
Wheat Germ (in vitro)
GST
Videos
SDS
Documentos
Certificados
Ofertas especiales

Ofertas especiales