missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human GUCY1A3 Partial ORF (AAH28384, 41 a.a. - 140 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00002982-Q01.25ug
Detalles adicionales : Peso : 0.00010kg
Descripción
Soluble guanylate cyclase (sGC), a heterodimeric protein consisting of an alpha subunit, such as alpha-1 (GUCY1A3), and a beta subunit, typically beta-1 (GUCY1B3; MIM 139397), catalyzes conversion of GTP to the second messenger cGMP and functions as the main receptor for nitric oxide and nitrovasodilator drugs (Zabel et al., 1998 [PubMed 9742212]).[supplied by OMIM]
Sequence: KATMPICQDIPEKNIQESLPQRKTSRSRVYLHTLAESICKLIFPEFERLNVALQRTLAKHKIKESRKSLEREDFEKTIAEQAVAAGVPVEVIKESLGEEVEspecificaciones
| AAH28384 | |
| Liquid | |
| 2982 | |
| GUCY1A3 (Human) Recombinant Protein (Q01) | |
| 25 ug | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| GC-SA3/GUC1A3/GUCA3/GUCSA3/GUCY1A1 | |
| GUCY1A3 | |
| Yes | |
| wheat germ expression system |
| Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein) | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.74kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| KATMPICQDIPEKNIQESLPQRKTSRSRVYLHTLAESICKLIFPEFERLNVALQRTLAKHKIKESRKSLEREDFEKTIAEQAVAAGVPVEVIKESLGEEV | |
| RUO | |
| GUCY1A3 | |
| Wheat Germ (in vitro) | |
| GST |